PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002755G0230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family M-type_MADS
Protein Properties Length: 105aa    MW: 11303.1 Da    PI: 11.0338
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002755G0230genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.4e-294392251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rie+ + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+lye++s
  PH01002755G0230 43 RIEDATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS 92
                     8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.1E-363493IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.8573494IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-273694IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003690IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-293656IPR002100Transcription factor, MADS-box
PfamPF003196.3E-274390IPR002100Transcription factor, MADS-box
CDDcd002655.64E-324492No hitNo description
PRINTSPR004042.1E-295671IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-297192IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MVATAAAAAR GEGQQIVAAP TPADSTVKAV KKTGRRGRRE MRRIEDATSR QVTFSKRRSG  60
LLKKAFELSV LCDAEVALIV FSPRGRLYEF ASATEYVRGL ISVC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-183693259Myocyte-specific enhancer factor 2A
3mu6_C4e-183693259Myocyte-specific enhancer factor 2A
3mu6_B4e-183693259Myocyte-specific enhancer factor 2A
3mu6_A4e-183693259Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0985091e-141FP098509.1 Phyllostachys edulis cDNA clone: bphylf003i12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011468730.12e-30PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_011468729.12e-30PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_011468732.12e-30PREDICTED: MADS-box protein SOC1-like isoform X2
RefseqXP_011468731.12e-30PREDICTED: MADS-box protein SOC1-like isoform X2
SwissprotA2Z9Q71e-31MAD56_ORYSI; MADS-box transcription factor 56
SwissprotP0C5B21e-31MAD56_ORYSJ; MADS-box transcription factor 56
TrEMBLW5H2011e-32W5H201_WHEAT; Uncharacterized protein
TrEMBLW5A7B22e-32W5A7B2_WHEAT; Uncharacterized protein
STRINGSi038299m3e-30(Setaria italica)
STRINGLOC_Os10g39130.12e-29(Oryza sativa Japonica Group)
STRINGBGIOSGA033356-PA3e-29(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.16e-28AGAMOUS-like 14